freeze-thaw is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-08-26. Numbers and descriptions here follow the published literature rather than marketing material.
Ipamorelin is a synthetic pentapeptide classified as a growth hormone secretagogue. Its sequence, Aib-His-D-2-Nal-D-Phe-Lys-NH2, combines three non-proteinogenic residues with a C-terminal amide. The N-terminal aminoisobutyric acid unit and the two aromatic D-amino acids distinguish it from peptides assembled only from standard L-amino acids. Its formula is C38H49N9O5, corresponding to an average mass near 711.9 Da. At neutral pH the molecule carries a net positive charge, a property that shapes its behaviour in chromatographic and electrophoretic systems.
The compound was developed at Novo Nordisk during the 1990s as part of a programme seeking secretagogues with improved selectivity. It was described in the peer-reviewed literature in 1998 alongside related pentapeptides from the same series. Investigators advanced it because it raised growth hormone output in animal models while leaving other pituitary hormones comparatively unaffected. The development code NNC 26-0161 appears in earlier reports, and ipamorelin later became the common designation in published work.
Research quantities of ipamorelin are typically distributed as a white to off-white lyophilized powder. The solid dissolves readily in water and in aqueous buffers, and stock solutions are commonly prepared in sterile water or a mildly acidic diluent. Adsorption to plastic and glass surfaces can reduce the concentration of very dilute solutions, so containers and transfer steps deserve attention when accurate concentrations matter. Reconstituted material is generally used promptly rather than held for extended periods.
Storage recommendations for the dry solid center on low temperature and low moisture, most often -20 °C in a sealed, desiccated container protected from light. Solutions are less stable than the powder and are usually kept cold and used within a short window. Freeze-thaw cycling is a recognized source of loss, and aliquoting before freezing is a standard precaution. These practices derive from general peptide handling principles rather than from a single published stability trial, so exact shelf lives should be treated as approximate.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H49N9O5 | Pentapeptide with C-terminal amide |
| Average mass | Approximately 711.9 Da | Value derived from the formula |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility | Soluble in water and aqueous acetonitrile | Dissolution aided by acidic diluents |
| Common synonyms | Ipamorelin; NNC 26-0161 | Code name used in early reports |
Lyophilized material is generally held at minus twenty degrees Celsius or lower, protected from moisture and light. Repeated excursions to room temperature cause condensation inside the vial and gradual moisture uptake, both of which shorten shelf life. Containers should be allowed to equilibrate before opening so that water does not condense on the solid. Dividing a batch into single-use aliquots reduces freeze-thaw cycling. Solid peptide handled this way is usually considered stable for months to years, while the same material in solution degrades on a much shorter timescale.
Common solvents for laboratory work include water, buffered saline, and dimethyl sulfoxide. Once dissolved, the peptide is exposed to hydrolysis and oxidation, and alkaline conditions accelerate breakdown. Low-binding plasticware and the addition of a carrier protein reduce losses to container surfaces, which can otherwise be substantial at low concentrations. Solutions are typically kept cold and used within days. Investigators working with the compound generally prepare fresh working dilutions rather than storing dilute stocks, and they avoid repeated warming of the same vial.
Peptides such as ipamorelin are subject to chemical and physical degradation. Hydrolysis of peptide bonds, oxidation of susceptible residues, and aggregation are common pathways that reduce purity over time. The rate of these processes depends on temperature, moisture, pH, and the number of freeze-thaw cycles a sample undergoes. Because the compound is typically handled as a lyophilized powder, controlling moisture during storage is a central concern. Degradation products can be detected with separation techniques that resolve the parent peptide from related impurities.
Lyophilized material is generally stored frozen and protected from light and moisture. Typical recommendations place dry powder at temperatures well below freezing, while reconstituted solutions are kept cold and used within a defined window. Repeated freezing and thawing should be avoided because it can promote aggregation and loss of material. The choice of solvent matters as well; compatibility with the intended diluent should be checked before preparation. These handling practices aim to preserve both the quantity and the integrity of the peptide.
RdRps are highly conserved in viruses and are related to telomerase, though the reason for this was an ongoing question as of 2009. The similarity led to speculation that viral RdRps are ancestral to human telomerase. The most famous example of RdRp is in poliovirus. The viral genome is composed of RNA, which enters the cell through receptor-mediated endocytosis. From there, the RNA acts as a template for complementary RNA synthesis. The complementary strand acts as a template for the production of new viral genomes that are packaged and released from the cell ready to infect more host cells. The advantage of this method of replication is that no DNA stage complicates replication. The disadvantage is that no 'back-up' DNA copy is available. Many RdRps associate tightly with membranes making them difficult to study. The best-known RdRps are polioviral 3Dpol, vesicular stomatitis virus L, and hepatitis C virus NS5B protein. Many eukaryotes have RdRps that are involved in RNA interference: these amplify microRNAs and small temporal RNAs and produce double-stranded RNA using small interfering RNAs as primers. These RdRps are used in defense mechanisms and can be appropriated by RNA viruses. Their evolutionary history predates the divergence of major eukaryotic groups.
The general detection scheme involves: Pneumatic nebulization of mobile phase from the analytical column forming an aerosol. Aerosol conditioning to remove large droplets. Evaporation of solvent from the droplets to form dried particles. Particle charging using an ion jet formed via corona discharge. Particle selection – an ion trap is used to excess ions and high mobility charged particles. Measurement of the aggregate charge of aerosol particles using a filter/electrometer. The CAD like other aerosol detectors, can only be used with volatile mobile phases. For an analyte to be detected it must be less volatile than the mobile phase. More detailed information on how CAD works can be found on the Charged Aerosol Detection for Liquid Chromatography Resource Center.
Similar structures include the 310 helix (i + 3 → i hydrogen bonding) and the π-helix (i + 5 → i hydrogen bonding). The α-helix can be described as a 3.613 helix, since the i + 4 spacing adds three more atoms to the H-bonded loop compared to the tighter 310 helix, and on average, 3.6 amino acids are involved in one ring of α-helix. The subscripts refer to the number of atoms (including the hydrogen) in the closed loop formed by the hydrogen bond.
Sources: en.wikipedia.org
ALK-negative ALCL tumor cells show products made by chimeric genes: DUSP22-IRF4 (many of which are fused at particular site and termed DUSP22-FRA7H) in 30% of the cases; TP63-TBL1XR1 in 8% of cases; and NFKB2-ROS1, NCOR2-ROS1, NFKB2-TYK2, or PABPC4-TYK2 in rare cases. They also show mutations in the JAK1 and/or STAT3 genes in 18% of cases; the MSC gene in 15% of cases, and the NOTCH1 gene in 15% of cases. About 24% of cases have a truncated ERBB4 gene. DUSP22 gene rearrangements have been associated with favorable outcomes in ALK-negative ALCL while TP63 gene arrangements are often associated with a poorer prognosis in various cancers. ALK-negative ALCL cells overexpress overactive STAT3 in 47% of cases and JAK1 in many cases. Many of these gene abnormalities appear to contribute to the development of ALK-negative ALCL.
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
It is a synthetic five-amino-acid peptide that acts as a growth hormone secretagogue. Three of its residues are non-standard amino acids, and the chain ends in an amide rather than a free acid. The molecule is small enough that it can be characterised by routine peptide analytical techniques.
It has not received marketing approval as a medicine in the United States or the European Union. Supplied material is generally described and handled as a research chemical. Regulatory treatment varies by jurisdiction, and some countries restrict growth hormone secretagogues under sports or medicines legislation.
Earlier secretagogues were associated with broader hormonal responses, including measurable changes in cortisol and prolactin. Reports on this peptide describe a narrower profile in which growth hormone release is the most prominent effect. The observation is influential because it shapes how the compound is compared with other members of the same receptor family.
Typical guidance is -20 °C in a sealed container with desiccant and protection from light. The powder tolerates handling better than a solution, but repeated warming and cooling is still avoided.